ShopDreamUp AI ArtDreamUp
Deviation Actions
Suggested Deviants
Suggested Collections
You Might Like…
Featured in Groups
dreamsemoeyegothgothicwickedashensorrowbluecreepydarkdarknessdeathdeathmetaldevildolldoomdoommetaldreamingevilevileyeeyesfallinggoregothicdarkhalloweenheavymetalhorrorhorrormacabremacabremacabrehorrormetalnightmarepremonitionpremonitionspsychicpurplesamhainscaryskullspookysupernaturaltenebrousundeadvampirevampireszombieashliedawnnelsongoremetalashlienelsongoremacabreashensorrowdesigns
Description
★ Tenebrous Premonitions ★
© Ashlie Dawn Nelson & Sean Nelson
Colab with My Hubby Sean Nelson, (AKA) silentfuneral & AloneintheDark68
★ ★ ★ ★ ★ STOCKS USED ★ ★ ★ ★ ★
(My Stock) - All resources are ours!
★ ★ ★ ★ ★ © COPYRIGHT NOTICE ★ ★ ★ ★ ★
★ © Ashlie Dawn Nelson & Sean Nelson
★ My work does not belong to public domain.
All materials in my gallery may not be reproduced, copied, edited,
published, transmitted or uploaded, in anyway without my written permission.
★ ★ ★ ★ ★ WANT TO USE MY ART? ★ ★ ★ ★ ★
★ I'm available for commission and consignments.
★ Buy my artwork for your book covers, CD covers, custom jewelry & more!
★ Send me a note for more info and prices or email me @ ashensorrow@gmail.com
★ Visit my Facebook art page! www.facebook.com/AshenSorrowDe…
Image size
1486x1347px 2.83 MB
© 2014 - 2024 AshlieNelson
Comments5
Join the community to add your comment. Already a deviant? Log In
Sweeet.